The only human cathelicidin antimicrobial peptide, studied for broad-spectrum antimicrobial activity, immunomodulation, angiogenesis promotion, and wound healing in research.
LL-37 is a 37-amino acid cationic amphipathic peptide — the only human cathelicidin — derived from the C-terminal region of the protein hCAP-18. It is produced primarily by neutrophils, macrophages, and epithelial cells as part of the innate immune response, making it a central component of the body's antimicrobial defense.
LL-37 has been studied extensively for its antimicrobial properties against gram-positive and gram-negative bacteria, fungi, enveloped viruses, and parasites. Its mechanism involves disruption of microbial membranes via electrostatic interaction with negatively charged phospholipids — a physical disruption mechanism that makes resistance development considerably harder than with conventional antibiotics. Research interest has intensified in the context of multidrug-resistant organisms.
Beyond antimicrobial activity, LL-37 modulates inflammation, acts as a chemoattractant, promotes angiogenesis, and has demonstrated wound healing activity in vitro and in vivo. Research has also examined its role in cancer biology, where context-dependent effects on tumor progression have been observed. This multifunctional profile makes LL-37 a compound of broad interest across infectious disease, immunology, and regenerative medicine research.
| Form | Lyophilized Powder |
|---|---|
| Dosage Per Vial | 5mg |
| Molecular Weight | 4493.33 g/mol |
| CAS Number | 154947-66-7 |
| Sequence / Structure | [LL-37, 37 aa] |
| Purity | ≥99% (HPLC verified) |
| Storage | Store at −20°C. Reconstitute with sterile water. Stable 7 days at 4°C post-reconstitution. |
| Research Use | In vitro / laboratory research only |
Submit a research inquiry and our team will respond within one business day.
Submit Research Inquiry →